Accommodation detail

Property story, room options, and location.

The destination layer stays minimal here so the detail widget, gallery, and map carry the experience.

Stay overview

Property detail and room selection

The widget below owns the property content, room stack, and map.

← Back to results
Der alpine Kraftplatz - Alpenrose / Cocoon Lodge
hotel
5★

Mountain accommodation

Der alpine Kraftplatz - Alpenrose / Cocoon Lodge

Mühltalweg 10 · 6212 Maurach am Achensee · AT

Our 5***** wellness hotel in Austria turns holidays into dreams. We look forward to spoiling you with our cordial hospitality and alpine wellness on more than 8,500 square metres of pool area, sauna and relaxing surroundings on Lake Achensee. As part of your…

Bett+Bike
pets welcomesaunadisabled accessibleindoor swimming poolfamily friendly

Location

OpenStreetMap view

Mühltalweg 10 · 6212 Maurach am Achensee · AT

Highlights

pets welcomesaunadisabled accessibleindoor swimming poolfamily friendly

Contact & check-in

Mühltalweg 10 · 6212 Maurach am Achensee · AT

Phone: +43(5243)52930

Email: info@alpenrose.at

Check-in: 15:00 -

Check-out: - 10:30

Facilities & criteria

double room/ssingle room/ssuite / scountryside hotelfamily hotellake hotelbaby change padbabysitter on requestchild reductionchild-friendlychildren's bedchildren's equipmentchildren's menuchildren's menuschildren's play areachildren's poolcrib/baby bedfacilities for childrenfull facilities for babieshighchair

Useful links

Room options and rate products

Compare the room category, who it suits, the rate format, and the current price before sending an availability request.

Room category

Double room, shower, toilet, balcony

1-3 guests

222.00 EUR

per unit · night

The name of our studio Rotspitz is not without reason. Just like the mountain peak of the same name in the Rofan, shades of red and warm colors dominate. But don't worry, the beautiful studio has nothing to do with a bivouac on the mountain.

deskhairdryermini-barradiosafetelephoneTVWiFi

Offer

Double room, shower, toilet, balcony

222.00 - 290.00 EUR

per unit · night

1-2 adults · 0-1 children · 1-2 beds

Request availability

Offer

Double room, shower, toilet, balcony

222.00 - 285.00 EUR

per unit · night

1-2 adults · 0-1 children · 2 beds

Request availability

Offer

Double room, shower, toilet, balcony

222.00 - 279.00 EUR

per unit · night

1-2 adults · 0-1 children · 2 beds

Request availability

Room category

Double room, separate toilet and shower/bathtub, balcony

1-5 guests

222.00 EUR

per unit · night

The name says it all. The bay window with a cozy seating area in the bedroom gives the room a very special charm, whether as a cuddle corner or family table. You can expect a comfortable living space with plenty of room to feel good.

showertoiletdouble bed (1 bed/2 mattresses)French bedbathrobefurniture suitehairdryermini-bar

Offer

Double room, separate toilet and shower/bathtub, balcony

222.00 - 290.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Double room, separate toilet and shower/bathtub, balcony

222.00 - 285.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Double room, separate toilet and shower/bathtub, balcony

222.00 - 279.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, balcony

1-5 guests

233.00 EUR

per unit · night

The queen of the Alps prepares you for rest. The Swiss stone pine exudes a wonderful scent and has positive effects on circulation, sleep, and overall well-being.

bathtubdouble sinkshowertoiletbathrobedeskhairdryermini-bar

Offer

Suite, separate toilet and shower/bathtub, balcony

233.00 - 307.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

233.00 - 302.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

233.00 - 296.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub

1-5 guests

227.00 EUR

per unit · night

Not only does the beautiful tiled stove emit a pleasant warmth, but the many loving details are heartwarming as well. While the native woods in the bedroom call back to nature, the large bathroom takes you into the modern era.

bathtubshowertoiletbalcony (in some rooms)bathrobedeskhairdryermini-bar

Offer

Suite, separate toilet and shower/bathtub

227.00 - 296.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub

227.00 - 289.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub

227.00 - 284.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, balcony

1-5 guests

239.00 EUR

per unit · night

The view from your balcony into our blooming residence garden is a dream come true. The cozy beds in a homely atmosphere also invite you to dream. For a wellness feeling around the clock.

bathtubshowertoiletbathrobedeskhairdryermini-barradio

Offer

Suite, separate toilet and shower/bathtub, balcony

239.00 - 314.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

239.00 - 308.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

239.00 - 303.00 EUR

per unit · night

1-3 adults · 0-2 children · 2-3 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, balcony

1-7 guests

244.00 EUR

per unit · night

While we can't (yet) guarantee sweet dreams, we can certainly promise healthy sleep. In the Alpenrose, you will find our new high-quality sleep system. Because we want you to recharge overnight in the Alpenrose.

bathtubshowertoiletdouble room/ssingle room/sbathroberadiosafe

Offer

Suite, separate toilet and shower/bathtub, balcony

244.00 - 317.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

244.00 - 312.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

244.00 - 306.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, balcony

1-7 guests

250.00 EUR

per unit · night

Chic and spacious, this suite presents itself. With the white wooden paneling and the generous spaces, you will feel like you are on cloud nine.

bathrobehairdryerradiosafeseparate bedroom/stelephoneTVwalk-in closet

Offer

Suite, separate toilet and shower/bathtub, balcony

250.00 - 324.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

250.00 - 318.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

250.00 - 313.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, 2 bed rooms

1-7 guests

259.00 EUR

per unit · night

Generosity is key in this suite. The wooden paneling creates a pleasant room atmosphere, and the large bathroom with luxurious marble is a private wellness area all to itself.

bathtubshowertoiletdouble room/ssingle room/sbathroberadiosafe

Offer

Suite, separate toilet and shower/bathtub, 2 bed rooms

259.00 - 336.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, 2 bed rooms

259.00 - 331.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, 2 bed rooms

259.00 - 324.00 EUR

per unit · night

1-4 adults · 0-3 children · 2-4 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, balcony

1-9 guests

265.00 EUR

per unit · night

In our largest residence suite, an overnight stay becomes an experience. Even a simple bath turns into something very special in the extraordinary panoramic bathtub, just like the night’s rest in the four-poster bed. Simply heavenly!

bathtubshowertoiletcanopy bednumber single bed/sbalconybathrobehairdryer

Offer

Suite, separate toilet and shower/bathtub, balcony

265.00 - 343.00 EUR

per unit · night

1-5 adults · 0-4 children · 2-5 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

265.00 - 337.00 EUR

per unit · night

1-5 adults · 0-4 children · 2-5 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

265.00 - 332.00 EUR

per unit · night

1-5 adults · 0-4 children · 2-5 beds

Request availability

Room category

Suite, shower, toilet, balcony

1-2 guests

223.00 EUR

per unit · night

Perfect for our solo traveling guests who desire some time for themselves. The loving details, bright wood, and warm light create a cozy atmosphere. Feeling at home made easy!

room/s with French bedbathrobedeskhairdryermini-barradiotelephone

Offer

Suite, shower, toilet, balcony

223.00 - 295.00 EUR

per unit · night

1 adults · 0-1 children · 1 beds

Request availability

Offer

Suite, shower, toilet, balcony

223.00 - 288.00 EUR

per unit · night

1 adults · 0-1 children · 1 beds

Request availability

Offer

Suite, shower, toilet, balcony

223.00 - 283.00 EUR

per unit · night

1 adults · 0-1 children · 1 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, terrace

2-8 guests

435.00 EUR

per unit · night

Our penthouse suite features an exclusive roof terrace and unique lake views. 1 bedroom, desk, satellite TV, Wi-Fi, radio, telephone, luxurious marble bathroom with heart-shaped bathtub and panoramic view, separate toilet, private herbal steam bath, walk-in closet, 1 additional bedroom with double bed, marble bathroom with glass bathtub and shower, separate toilet, large living room with seating area and tiled stove, minibar with non-alcoholic drinks, espresso machine, cozy lounge.

bathtubno. of bathroomsbathrobecoffeemakerhairdryermini-barradiosafe

Offer

Suite, separate toilet and shower/bathtub, terrace

435.00 - 515.50 EUR

per unit · night

2-4 adults · 0-4 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, terrace

435.00 - 515.50 EUR

per unit · night

2-4 adults · 0-4 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, terrace

435.00 - 515.50 EUR

per unit · night

2-4 adults · 0-4 children · 2-4 beds

Request availability

Room category

Hotel suite, separate toilet and shower/bathtub, 3 bed rooms

2-8 guests

214.50 EUR

per unit · night

In our garden villa, you will be the master of your exclusive private domain for the duration of your vacation. The proximity to the pool invites spontaneous refreshment, but you can also relax wonderfully in the round bathtub in the luxurious bathroom. Exclusive holiday home for 2 to 4 people. With direct access to the main building, 1 bedroom with a cozy sitting area, walk-in closet, luxurious bathroom with round bathtub, shower, 2 separate WCs, hairdryer, 2 single rooms each with a French bed (1.4 m) with their own shower/WC, exclusive living room with a cozy seating area and dining area, kitchen, parlor with tiled stove, stereo system, telephone, satellite TV, Wi-Fi safe, and balcony.

bathtubno. of bathroomsno. of toiletsshowerdouble bed (1 bed/2 mattresses)French bedbalconyhairdryer

Offer

Holiday home, separate toilet and shower/bathtub

214.50 - 466.00 EUR

per unit · night

2-4 adults · 0-4 children · 2-4 beds

Request availability

Offer

Hotel suite, separate toilet and shower/bathtub, 3 bed rooms

380.00 - 466.00 EUR

per unit · night

2-4 adults · 0-4 children · 2-4 beds

Request availability

Offer

Hotel suite, separate toilet and shower/bathtub, 3 bed rooms

233.00 - 466.00 EUR

per unit · night

2-4 adults · 0-4 children · 2-4 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub

1-3 guests

307.00 EUR

per unit · night

This suite is clad in old oak in a modern Alpine style.

bathtubbidettoiletdouble bed (1 bed/2 mattresses)coffeemakerfireplacehairdryerinfrared cabin in room/apt.

Offer

Suite, separate toilet and shower/bathtub

307.00 - 399.00 EUR

per unit · night

1-2 adults · 0-1 children · 2 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub

307.00 - 395.00 EUR

per unit · night

1-2 adults · 0-1 children · 2 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub

307.00 - 382.00 EUR

per unit · night

1-2 adults · 0-1 children · 2 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, balcony

2-6 guests

322.00 EUR

per unit · night

This suite is adorned with aged oak in a modern alpine style.

bathtubbidettoiletnumber double bed/snumber single bed/smini-barsafeseparate bedroom/s

Offer

Suite, separate toilet and shower/bathtub, balcony

322.00 - 416.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

322.00 - 413.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

322.00 - 399.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Room category

Suite, separate toilet and shower/bathtub, balcony

2-6 guests

422.00 EUR

per unit · night

This two-storey suite is clad in aged oak in a modern alpine style.

coffeemakerfireplaceinfrared cabin in room/apt.mini-barsaunatelephoneTVwalk-in closet

Offer

Suite, separate toilet and shower/bathtub, balcony

422.00 - 532.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

422.00 - 529.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Offer

Suite, separate toilet and shower/bathtub, balcony

422.00 - 518.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Room category

Suite, shower, toilet

2-6 guests

497.00 EUR

per unit · night

This suite is decorated with aged oak in a modern Alpine style.

bathtubbidetno. of bathroomsshowertoiletcoffeemakerfireplacehairdryer

Offer

Suite, shower, toilet

497.00 - 619.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Offer

Suite, shower, toilet

497.00 - 616.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability

Offer

Suite, shower, toilet

497.00 - 601.00 EUR

per unit · night

2-4 adults · 0-2 children · 2-4 beds

Request availability
Direct request flow
Online checkout is intentionally out of scope here. Use request availability once you have chosen the right room and rate.

Need another area or stay type? Back to the shortlist with your current search state intact.